Recombinant Saccharomyces cerevisiae Nucleoside diphosphate kinase (YNK1)

In Stock
Code CSB-EP015889SVG
MSDS
Size US$388
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 85% as determined by SDS-PAGE.
Target Names
YNK1
Uniprot No.
Research Area
Others
Alternative Names
YNK1; NDK1; YNK; YKL067W; YKL333; Nucleoside diphosphate kinase; NDK; NDP kinase; EC 2.7.4.6
Species
Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
Source
E.coli
Expression Region
1-153aa
Target Protein Sequence
MSSQTERTFIAVKPDGVQRGLVSQILSRFEKKGYKLVAIKLVKADDKLLEQHYAEHVGKPFFPKMVSFMKSGPILATVWEGKDVVRQGRTILGATNPLGSAPGTIRGDFGIDLGRNVCHGSDSVDSAEREINLWFKKEELVDWESNQAKWIYE
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Mol. Weight
37.2 kDa
Protein Length
Full Length
Tag Info
N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

This Saccharomyces cerevisiae YNK1 recombinant protein was produced in E.coli, where the gene sequence encoding Saccharomyces cerevisiae YNK1 (1-153aa) was expressed with the N-terminal 10xHis-SUMO tag and C-terminal Myc tag. The purity of this YNK1 protein was greater than 85% by SDS-PAGE.
Ynk1 protein typically possesses a catalytic domain associated with the nucleoside diphosphate kinase family. Its function can vary depending on the physiological state and needs of Saccharomyces cerevisiae cells. Ynk1 is a nucleoside diphosphate kinase, and it plays an important biological role in Saccharomyces cerevisiae cells. Similar to other nucleoside diphosphate kinases, Ynk1 is responsible for catalyzing the reaction of nucleoside diphosphorylation, converting a nucleoside monophosphate into a nucleoside diphosphate. This process plays a crucial role in nucleoside metabolism within the cell and is closely associated with processes like energy transfer and DNA synthesis. Furthermore, one of the primary biological roles of Ynk1 is to maintain the production of ATP within Saccharomyces cerevisiae cells. ATP is the cell's primary energy molecule, supplying energy for various biological processes such as cell division, protein synthesis, and transportation.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Major role in the synthesis of nucleoside triphosphates other than ATP. The ATP gamma phosphate is transferred to the NDP beta phosphate via a ping-pong mechanism, using a phosphorylated active-site intermediate. Required for repair of UV radiation- and etoposide-induced DNA damage.
Gene References into Functions
  1. Crystal structure of Ynk1 provides further insights into the interface and interactions between the dimers and the conserved residues involved in quaternary-structure formation. PMID: 18607079
  2. The study indicates a novel role for YNK1 in DNA repair in yeast, and suggests an anti-mutator function that may contribute to the metastasis suppressor function of NM23-H1 in humans. PMID: 18983998
Subcellular Location
Cytoplasm. Mitochondrion intermembrane space. Note=Localizes predominantly to the cytoplasm. A small fraction is present in the mitochondrial intermembrane space.
Protein Families
NDK family
Database Links

KEGG: sce:YKL067W

STRING: 4932.YKL067W

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2024 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*